PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30520.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 285aa    MW: 32565.2 Da    PI: 4.5822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30520.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
  mrna30520.1-v1.0-hybrid 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding51.72e-1671111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +  E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  mrna30520.1-v1.0-hybrid  71 SDNEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                              6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-20562IPR009057Homeodomain-like
PROSITE profilePS5129413.636961IPR017930Myb domain
SuperFamilySSF466898.99E-2711108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001672.19E-81661No hitNo description
PROSITE profilePS5129425.65162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2463117IPR009057Homeodomain-like
SMARTSM007173.9E-1466114IPR001005SANT/Myb domain
PfamPF002494.5E-1471111IPR001005SANT/Myb domain
CDDcd001672.98E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDNEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPLTHKPLS NGNEVDNQPQ KKQQIQNDQE QQQQEEEQSC TATDDTFEID QINEEAKEED  180
KIEFVTMDHE LLNGFCIDEV PLIEPHEIHL VPDCDPSSST SSSSSSSNSS SNFLEDLQYL  240
PDFEWPNSDY SNNNNNIIID NDTMSLWDDD FSSWGQESWA FGVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289590.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-87ODO1_PETHY; Protein ODORANT1
TrEMBLM5XD571e-123M5XD57_PRUPE; Uncharacterized protein
STRINGGLYMA02G41180.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.18e-93myb domain protein 20